PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01793.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 269aa    MW: 30445.7 Da    PI: 5.8644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01793.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l++ +   G  +W++ ++  g++R++k+c++rw +yl
  Rsa1.0_01793.1_g00004.1 14 KGPWTAEEDKKLINFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding45.91.3e-1471111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              + +E++l +d+++ lG++ W++Ia++++ gRt+++ k++w+++
  Rsa1.0_01793.1_g00004.1  71 SHDEEQLVIDLHAHLGNK-WSKIASRLP-GRTDNETKNHWNTH 111
                              789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.1961IPR017930Myb domain
SuperFamilySSF466896.27E-2612108IPR009057Homeodomain-like
SMARTSM007176.2E-121363IPR001005SANT/Myb domain
PfamPF002497.0E-141461IPR001005SANT/Myb domain
CDDcd001675.00E-91661No hitNo description
PROSITE profilePS5129425.70962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2363117IPR009057Homeodomain-like
SMARTSM007177.9E-1366114IPR001005SANT/Myb domain
CDDcd001677.53E-1071112No hitNo description
PfamPF002497.7E-1371111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRQPCCDKL EVKKGPWTAE EDKKLINFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SHDEEQLVID LHAHLGNKWS KIASRLPGRT DNETKNHWNT HIKKKLVKMG  120
IDPVTHQPLN QETNNTDNPK NSSSTSDDIS MEPKSSSTKN EETNSTTTED ESSSTATGQN  180
SSINIENQLL NNNNNDEELF SYLWSDDSAK ADASRSCCDY YGLGGTLYYE DNISCAGADF  240
PIWSSERVSG KDYMFLDYCQ DFGVHDFGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741428.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-90ODO1_PETHY; Protein ODORANT1
TrEMBLA0A078JFF50.0A0A078JFF5_BRANA; BnaA03g58600D protein
STRINGBra019368.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.11e-122myb domain protein 85